InnoPep Inc.
8 products found

InnoPep Inc. products

Adhesion Peptides

Model 3132-0100 - Bacterial Sortase Substrate I, FRET DABCYL - LPETG - EDANS

This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.

Model 3171-0100 - Hyaluronan Inhibitor GAHWQFNALTVR

This 12 amino acids peptide is a hyaluronan inhibitor (HA), a high molecular weight glycosaminoglycan expressed abundantly in the extracellular matrix and on cell surfaces. This peptide shows specific binding to soluble, immobilized, and cell-associated forms of HA, and it inhibits leukocyte adhesion to HA substrates almost completely.

Adrenomedullin and Related Peptides

Model 3432-0050 - Adrenomedullin (1 - 50), rat YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY - NH2 (Disulfide bridge: 14 - 19)

Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.

Amylin (IAPP) and Fragments

Model 3271-0100 - [NMeG24, NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22 - 27) NF - (NMe - G) - A - (NMe - I) - L

This amino acids 22 to 27 fragment is a modification of the human islet amyloid polypeptide hIAPP (NFGAIL) with N-methylation of the amide bonds at G24 and I26. The introduction of two N-methyl rests in the amyloid-core-containing sequence NFGAIL converts this amyloidogenic and cytotoxic sequence into non-amyloidogenic and non-cytotoxic peptide. The peptide is able to bind with high-affinity full-length hIAPP and to inhibit its fibrillogenesis.



Angiotensins and Fragments

Model 3143-0100 - Angiotensin II Substrate DRV - pY - IHPF

This is a tyrosine phosphorylated angiotensin II peptide with a substrate sequence specificity for chymase to act. This is an octapeptide hormone that is formed as a result of the action of human heart chymase, a chymotrypsin-like serine protease on the Phe-His bond of Angiotensin I. The ideal susbtrate for human heart chymase should contain this peptide sequence, and has been demonstrated that the Pro-Phe sequence in P2-P1 positions of peptide substrates is highly favored by leukocyte chymotrypsin-like proteinases such as chymases and cathepsin G.

Bacterial Peptides

Model 3128-0100 - SPase I FRET Substrate Dabcyl - AGHDAHASET - Edans

This is a type I signal peptidase (SPase1) substrate peptide labeled with EDANS/ DABCYL FRET pair, and contains a crucial cleavage site derived from the C-terminal region of the Staphylococcus epidermidis pre-SceD protein. Abs/Em = 340/490 nm.

DNA-Binding Peptides

Model 3070-0100 - Histone H3 (15 - 36) - GGK (Biotin)

This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine.

Fibrinogen and Related Peptides

Model 3151-0100 - [Glu1] - Fibrinopeptide B Glufib

This peptide is derived from fibrinopeptide B amino acid residues 1-14. It is used as a mass spec (MS) standard in proteomic research.