AAA Biotech

AAA BiotechModel BAG1 -Mouse Monoclonal Antibody

SHARE

BAG1, Antibody; BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46) (PE); anti-BAG1 antibody.

Most popular related searches
Applicable Applications for anti-BAG1 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
 
Application Notes
IF: 35ug/ml
Applications are based on unconjugated antibody.
 
Immunogen
Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.
 
Immunogen Sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Conjugate
PE
 
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Product Notes

The BAG1 bag1 (Catalog #AAA25622) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BAG1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 35ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAG1 bag1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.