Mol Scientific

Mol ScientificModel MPE0011515 -Corticotropin Releasing Factor, bovine

SHARE
Mol Scientific offer high-quality Corticotropin Releasing Factor, bovine product(MPE0011515). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Corticotropin Releasing Factor, bovine
Cat #: MPE0011515
Molecular Formula:C206H340N60O63S
Molecular Weight:SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA
Three letter code:Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Peptide Purity (HPLC):>95%; 98% and 99% purity available upon request
Quantity/Unit:1 Vial