Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0000589 - ...

Mol ScientificModel MPE0000589 -Esculentin-2-OR5 peptide

SHARE
Mol Scientific offer high-quality Esculentin-2-OR5 peptide product(MPE0000589). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific

Product Name: Esculentin-2-OR5 peptide

Cat #: MPE0000589

Molecular Formula:

Molecular Weight:GVFTLIKGATQLIGKTLGKELGKTGLEIMACKITKQC

Three letter code:Gly-Val-Phe-Thr-Leu-Ile-Lys-Gly-Ala-Thr-Gln-Leu-Ile-Gly-Lys-Thr-Leu-Gly-Lys-Glu-Leu-Gly-Lys-Thr-Gly-Leu-Glu-Ile-Met-Ala-Cys-Lys-Ile-Thr-Lys-Gln-Cys

Peptide Purity (HPLC):

Quantity/Unit:1 Vial