Mol Scientific
- Home
- Companies
- Mol Scientific
- Products
- Mol Scientific - Model MPE0000589 - ...
Mol Scientific - Model MPE0000589 -Esculentin-2-OR5 peptide
FromMol Scientific
Mol Scientific offer high-quality Esculentin-2-OR5 peptide product(MPE0000589). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches
Brand: Mol Scientific
Product Name: Esculentin-2-OR5 peptide
Cat #: MPE0000589
Molecular Formula:
Molecular Weight:GVFTLIKGATQLIGKTLGKELGKTGLEIMACKITKQC
Three letter code:Gly-Val-Phe-Thr-Leu-Ile-Lys-Gly-Ala-Thr-Gln-Leu-Ile-Gly-Lys-Thr-Leu-Gly-Lys-Glu-Leu-Gly-Lys-Thr-Gly-Leu-Glu-Ile-Met-Ala-Cys-Lys-Ile-Thr-Lys-Gln-Cys
Peptide Purity (HPLC):
Quantity/Unit:1 Vial
