Mol Scientific

Mol ScientificModel MPE0002635 -Corticotropin-releasing factor [1-40; E26, N40] peptide

SHARE
Mol Scientific offer high-quality Corticotropin-releasing factor [1-40; E26, N40] peptide product(MPE0002635). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Corticotropin-releasing factor [1-40; E26, N40] peptide
Cat #: MPE0002635
Molecular Formula:C200H326N58O65S2
Molecular Weight:SEEPPISLDLTFHLLREVLEMARAEELAQQAHSNRKLMEN
Three letter code:H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Glu-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Asn-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial