Mol Scientific
- Home
- Companies
- Mol Scientific
- Products
- Mol Scientific - Model MPE0011598 - pTH ...
Mol Scientific - Model MPE0011598 -pTH (3-34) (bovine)
FromMol Scientific
Mol Scientific offer high-quality pTH (3-34) (bovine) product(MPE0011598). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches
Brand: Mol Scientific
Product Name: pTH (3-34) (bovine)
Cat #: MPE0011598
Molecular Formula:C175H274N52O48S2
Molecular Weight:SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF
Three letter code:Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Peptide Purity (HPLC):>95%; 98% and 99% purity available upon request
Quantity/Unit:1 Vial
