Mol Scientific

Mol ScientificModel MPE0011236 -[Tyr0]-alpha-CGRP, human

SHARE
Mol Scientific offer high-quality [Tyr0]-alpha-CGRP, human product(MPE0011236). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: [Tyr0]-alpha-CGRP, human
Cat #: MPE0011236
Molecular Formula:C172H276N52O51S2
Molecular Weight:YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF(Disulfide bridge: Cys 2-Cys 7)
Three letter code:Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (Disulfide bridge: Cys 2-Cys 7)
Peptide Purity (HPLC):>95%; 98% and 99% purity available upon request
Quantity/Unit:1 Vial