Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0011235 - ...

Mol ScientificModel MPE0011235 -[Tyr0]-alpha-CGRP, [Tyr0]-alpha-CGRP, rat

SHARE
Mol Scientific offer high-quality [Tyr0]-alpha-CGRP, [Tyr0]-alpha-CGRP, rat product(MPE0011235). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: [Tyr0]-alpha-CGRP, [Tyr0]-alpha-CGRP, rat
Cat #: MPE0011235
Molecular Formula:C171H271N51O54S2
Molecular Weight:YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF(Disulfide bridge: Cys 2-Cys 7)
Three letter code:Tyr-Ser-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2 (Disulfide bridge: Cys 2-Cys 7)
Peptide Purity (HPLC):>95%; 98% and 99% purity available upon request
Quantity/Unit:1 Vial